Jump to content

Blepharisma nuclear code

From Wikipedia, the free encyclopedia
This is an old revision of this page, as edited by Monkbot (talk | contribs) at 03:23, 20 October 2020 (Task 17 (BRFA trial): delete deprecated: |last-author-amp= (1× deleted; usage: 0 of 2); replace to-be-deprecated: |name-list-format= (1× replaced; usage: 1 of 1);). The present address (URL) is a permanent link to this revision, which may differ significantly from the current revision.

The Blepharisma nuclear code (translation table 15) is a genetic code found in the nuclei of Blepharisma.[1]

Code

   AAs = FFLLSSSSYY*QCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

DNA codons RNA codons This code (15) Standard code (1)
TAG UAG Gln (Q) STOP = Ter (*)

Systematic range and comments

Ciliata: Blepharisma[2]

See also

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. [3]

  1. ^ Andrzej Elzanowski; Jim Ostell (26 September 1996). "The Genetic Codes". National Center for Biotechnology Information. Archived from the original on 14 March 2016. Retrieved 20 January 2017.
  2. ^ A Liang, K Heckman (1993). "Blepharisma uses UAA as a termination codon". Naturwissenschaften. 80 (5): 225–226. doi:10.1007/bf01175738. PMID 7685500. S2CID 6219316.
  3. ^ Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 3 July 2016.