Jump to content

Blastocrithidia nuclear code

From Wikipedia, the free encyclopedia
This is an old revision of this page, as edited by Manudouz (talk | contribs) at 19:13, 23 January 2017 (Adding the reference section + categories.). The present address (URL) is a permanent link to this revision, which may differ significantly from the current revision.

The Blastocrithidia nuclear code (translation table 31) is a genetic code used by the nuclear genome of the trypanosomatid Blastocrithidia.[1]

The code (31)

   AAs = FFLLSSSSYYEECCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = ----------**-----------------------M----------------------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).

Differences from the standard code

Codons This code (31) Standard code (1)
UAA Glu (E)   or    Ter (*) Ter (*)
UAG Glu (E)   or    Ter (*) Ter (*)
UGA Trp (W) Ter (*)

See also

References

  • This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski and Jim Ostell.[2]
  1. ^ Záhonová, Kristína; Kostygov, Alexei Y.; Ševčíková, Tereza; Yurchenko, Vyacheslav; Eliáš, Marek. "An Unprecedented Non-canonical Nuclear Genetic Code with All Three Termination Codons Reassigned as Sense Codons". Current Biology. 26 (17): 2364–2369. doi:10.1016/j.cub.2016.06.064.
  2. ^ The Genetic Codes (update: Nov. 18, 2016)