Jump to content

Blepharisma nuclear code

From Wikipedia, the free encyclopedia
This is an old revision of this page, as edited by Icebob99 (talk | contribs) at 13:55, 20 January 2017 (Differences from the standard code: code 15 to code 10 with ref). The present address (URL) is a permanent link to this revision, which may differ significantly from the current revision.

The Blepharisma nuclear code (translation table 15) is a genetic code found in the nuclei of Blepharisma.

Code

   AAs = FFLLSSSSYY*QCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

Starts = -----------------------------------M----------------------------

 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)


Differences from the standard code

Differences from the standard code:
Code 10[1] Standard
UAG Gln Ter

Systematic range and comments

Ciliata: Blepharisma[2]

See also

References

  • This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski and Jim Ostell.[3]
  1. ^ Andrzej Elzanowski; Jim Ostell (26 September 1996). "The Genetic Codes". National Center for Biotechnology Information. Archived from the original on 20 January 2017. Retrieved 20 January 2017. {{cite web}}: |archive-date= / |archive-url= timestamp mismatch; 14 March 2016 suggested (help); Unknown parameter |deadurl= ignored (|url-status= suggested) (help)
  2. ^ A Liang; K Heckman (1993). "Blepharisma uses UAA as a termination codon". Naturwissenschaften. 80: 225–226. doi:10.1007/bf01175738. {{cite journal}}: Unknown parameter |last-author-amp= ignored (|name-list-style= suggested) (help)
  3. ^ The Genetic Codes