Jump to content

Chlorophycean mitochondrial code

From Wikipedia, the free encyclopedia
This is an old revision of this page, as edited by Rich Farmbrough (talk | contribs) at 12:03, 10 August 2016 (Created page with ''''The chlorophycean mitochondrial code(translation table 16) is a genetic code foundS in ''Chlorophyceae''. ==Code== {{Genetic code |FFLLSSSSYY*LCC*WLL...'). The present address (URL) is a permanent link to this revision, which may differ significantly from the current revision.
(diff) ← Previous revision | Latest revision (diff) | Newer revision → (diff)

The chlorophycean mitochondrial code(translation table 16) is a genetic code foundS in Chlorophyceae.

Code

   AAs = FFLLSSSSYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

Starts = -----------------------------------M----------------------------

 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)


Differences from the standard code

Differences from the standard code:
Code 16 Standard
TAG Leu Stop

Systematic range and comments

Chlorophyceae[1] and the chytridiomycete fungus Spizellomyces punctatus [2]

See also

References

  • This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski and Jim Ostell.[3]
  1. ^ Y Hayashi-Ishimaru, T Ohama, Y Kawatsu, K Nakamura, S Osawa (June 1996). "UAG is a sense codon in several chlorophycean mitochondria". Current Genetics. 30 (1): 29–33. PMID 8662206S. {{cite journal}}: Check |pmid= value (help)CS1 maint: multiple names: authors list (link)
  2. ^ (Laforest et al. 1997. Mitochondrial tRNAs in the lower fungus Spizellomyces punctatus: tRNA editing and UAG 'stop' codons recognized as leucine).
  3. ^ The Genetic Codes