Jump to content

Blepharisma nuclear code

From Wikipedia, the free encyclopedia
This is an old revision of this page, as edited by Rjwilmsi (talk | contribs) at 11:59, 8 August 2016 (Systematic range and comments: Journal cites, Added 1 doi to a journal cite using AWB (12066)). The present address (URL) is a permanent link to this revision, which may differ significantly from the current revision.

The Blepharisma nuclear code (translation table 15) is a genetic code found in the nuclei of Blepharisma.

Code

   AAs = FFLLSSSSYY*QCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

Starts = -----------------------------------M----------------------------

 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)


Differences from the standard code

Differences from the standard code:
Code 14 Standard
UAG Gln Ter


Systematic range and comments

Ciliata: Blepharisma[1]

See also

References

  • This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski and Jim Ostell.[2]
  1. ^ "Blepharisma uses UAA as a termination codon". Naturwissenschaften. 80: 225–226. 1993. doi:10.1007/bf01175738. {{cite journal}}: Unknown parameter |authors= ignored (help)
  2. ^ The Genetic Codes