Alternative flatworm mitochondrial code
{{Subst:PAGEANME}} (translation table 14) is a genetic code found in the mitochondria of Platyhelminthes and Nematoda.
Code
AAs = FFLLSSSSYYY*CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNNKSSSSVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG
Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).
Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)
Differences from the standard code
| Code 14 | Standard | |
|---|---|---|
| AAA | Asn | Lys |
| AGA | Ser | Arg |
| AGG | Ser | Arg |
| UAA | Tyr | Ter |
| UGA | Trp | Ter |
Systematic range and comments
Platyhelminthes (flatworms) and Nematoda (roundworms).
Code 14 differs from code 9 (the echinoderm and flatworm mitochondrial code)only by translating UAA to Tyr rather than STOP. A recent study[1] has found no evidence that the codon UAA codes for Tyr in the flatworms but other opinions exist. There are very few GenBank records that are translated with code 14 but a test translation shows that re-translating these records with code 9 can cause premature terminations. More recently, UAA has been found to code for tyrosine in the nematodes Radopholus similis[2] and Radopholus arabocoffeae.[3]
See also
References
- This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski and Jim Ostell.[4]
- ^ Telford et al. 2000
- ^ Joachim EM Jacob, Bartel Vanholme, Thomas Van Leeuwen and Godelieve Gheysen1 (2009). "A unique genetic code change in the mitochondrial genome of the parasitic nematode Radopholus similis".
{{cite journal}}: Cite journal requires|journal=(help)CS1 maint: multiple names: authors list (link) CS1 maint: numeric names: authors list (link) - ^ http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?name=Radopholus+arabocoffeae
- ^ The Genetic Codes