Jump to content

Invertebrate mitochondrial code

From Wikipedia, the free encyclopedia
This is an old revision of this page, as edited by Rich Farmbrough (talk | contribs) at 20:19, 26 August 2015. The present address (URL) is a permanent link to this revision, which may differ significantly from the current revision.

The invertebrate mitochondrial code is a genetic code used by the mitochondrial genome of invertebrates.

The code

   AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSSSSVVVVAAAADDEEGGGG
Starts = ---M----------------------------MMMM---------------M------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Note: The codon AGG is absent in Drosophila.

Differences from the standard code:
This code Standard
AGA Ser S Arg R AGG Ser S Arg R AUA Met M Ile I UGA Trp W Ter *

Alternative initiation codons:

  • AUA, AUU
  • AUC: Apis [1]
  • GUG: Polyplacophora [2]
  • UUG: Ascaris, Caenorhabditis

Systematic range

Other variations

  • Several arthropods translate the codon AGG as lysine instead of serine (as in the Pterobranchia Mitochondrial Code) or arginine (as in the standard genetic code) (Abascal et al., 2006).
  • GUG may possibly function as an initiator in Drosophila (Clary and Wolstenholme, 1985; Gadaleta et al., 1988). AUU is not used as an initiator in Mytilus (Hoffmann et al., 1992).
  • "An exceptional mechanism must operate for initiation of translation of the cytochrome oxidase subunit I mRNA in both D. melanogaster (de Bruijn, 1983) and D. yakuba (Clary and Wolstenholme 1983), since its only plausible initiation codon, AUA, is out of frame with the rest of the gene. Initiation appears to require the "reading" of of an AUAA quadruplet, which would be equivalent to initiation at AUA followed immediately by a specific ribosomal frameshift. Another possible mechanism ... is that the mRNA is "edited" to bring the AUA initiation into frame." (Fox, 1987)

References

  • This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski, Jim Ostell, Detlef Leipe, Vladimir Soussov..[3]
  1. ^ Attention: This template ({{cite pmid}}) is deprecated. To cite the publication identified by PMID 8417993, please use {{cite journal}} with |pmid=8417993 instead.
  2. ^ Boore and Brown, 1994 GenBank Accession Number:U09810
  3. ^ "The Genetic Codes". Retrieved 26 August 2015.